PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_009950-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 344aa    MW: 38855.8 Da    PI: 6.8162
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_009950-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.4e-181360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
    NNU_009950-RA 13 RGLWSPEEDEKLIRYITTHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 60
                     788*******************************************97 PP

2Myb_DNA-binding51.22.8e-1666109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ +++d+++ lG++ W+ Ia++++ gRt++++k++w++
    NNU_009950-RA  66 RGSFSAQEERIIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 109
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-27463IPR009057Homeodomain-like
PROSITE profilePS5129418.569860IPR017930Myb domain
SuperFamilySSF466894.49E-2910107IPR009057Homeodomain-like
SMARTSM007171.1E-131262IPR001005SANT/Myb domain
PfamPF002493.9E-161360IPR001005SANT/Myb domain
CDDcd001671.41E-111660No hitNo description
PROSITE profilePS5129425.75761115IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-2564115IPR009057Homeodomain-like
SMARTSM007178.8E-1665113IPR001005SANT/Myb domain
PfamPF002491.1E-1466109IPR001005SANT/Myb domain
CDDcd001673.56E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLIRYITT HGHGCWSSVP KLAGLQRCGK SCRLRWINYL  60
RPDLKRGSFS AQEERIIIDV HRILGNRWAQ IAKHLPGRTD NEVKNFWNSC IKKKLLAQGL  120
DPKTHNLISS HHTTNNNNAC NLLHTHQQPI FTVETQTRER SSITINPPFI TLPPPPPPPP  180
PPPPPPLHPI TTTTTTAAHH PPLHEAITNP IYDYQNPNLV WNAKAQNLLA SVDFVGRSPM  240
DSVPISSATN HPSGLGYLEE NCIWTTSAEP FEPPKQQEMQ QLQQQQQQEV CDVEFDDANE  300
VKGSQDMETS FNSSNFDIDF VDSTMMPCGM YCTSTSMDQI AWDC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260795.10.0PREDICTED: myb-related protein Pp2-like
TrEMBLB9GN081e-123B9GN08_POPTR; Uncharacterized protein
STRINGPOPTR_0001s12240.11e-123(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.11e-85myb domain protein 67